| 2.01 new install, posting error
2.01 VB3 enhanced new install, and I'm getting an error when uploading an ad. When I hit submit, it spits out the following error on the following page:
Warning: mysql_num_rows(): supplied argument is not a valid MySQL result resource in varwwwmysite.nethtmlclassifiedsuploadproduct.php on line 233
(my domain was replaced with "mysite.net" in the error string)
It ends up redirecting correctly, and the ad shows up correctly, so I'm not sure why this error spits out, or what it means.
|