PhotoPost Photo Gallery Sales PhotoPost Sales Toll Free Phone Number
Mon-Fri 9am-4pm EST
  PhotoPost Photo Sharing Photo Gallery    Visualize community tm
| | | | | | | | |

Go Back   PhotoPost Community > PhotoPost Support > PhotoPost Classifieds Support > Classifieds Installation & Upgrades

Classifieds Installation & Upgrades If you're having install or upgrade problems, post here.

Reply
 
LinkBack Thread Tools Rate Thread Display Modes
Old February 17th, 2005, 10:16 AM   #1 (permalink)
Member
Verified Customer
 
Join Date: Feb 2002
Posts: 248
2.01 new install, posting error

2.01 VB3 enhanced new install, and I'm getting an error when uploading an ad. When I hit submit, it spits out the following error on the following page:

Warning: mysql_num_rows(): supplied argument is not a valid MySQL result resource in varwwwmysite.nethtmlclassifiedsuploadproduct.php on line 233

(my domain was replaced with "mysite.net" in the error string)

It ends up redirecting correctly, and the ad shows up correctly, so I'm not sure why this error spits out, or what it means.
ludachris is offline   Reply With Quote
Old February 20th, 2005, 04:18 PM   #2 (permalink)
Photopost Developer
Verified Customer
 
Chuck S's Avatar
 
Join Date: Jun 2002
Location: Abingdon,MD
Posts: 68,069
Check your data and uploads paths and ensure they are correct.
__________________
Photopost Developer and Support Engineer

Please do not PM me for support or sales questions. Thank you for your understanding.
Chuck S is offline   Reply With Quote
Reply


Currently Active Users Viewing This Thread: 1 (0 members and 1 guests)
 
Thread Tools
Display Modes Rate This Thread
Rate This Thread:

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is Off
Trackbacks are On
Pingbacks are On
Refbacks are On


Similar Threads
Thread Thread Starter Forum Replies Last Post
Error on posting a picture ehm Photopost Pro Installation & Upgrades 2 January 27th, 2005 12:48 PM
Wanted Posting Error HobbyTalk Classifieds Bug Reports 10 December 12th, 2004 02:41 PM
Error - Posting a Review InterFX ReviewPost Bug Reports 2 November 17th, 2004 07:42 PM
SQL error after posting review ChopperWeb ReviewPost Bug Reports 2 September 29th, 2004 10:57 PM
MySQL error after posting review bloud ReviewPost Bug Reports 5 September 24th, 2004 11:30 AM


All times are GMT -5. The time now is 07:14 AM.

Powered by vBulletin® Version 3.8.1
Copyright ©2000 - 2012, Jelsoft Enterprises Ltd.
Search Engine Friendly URLs by vBSEO 3.2.0